Anti-YES1 (v-yes-1 Yamaguchi Sarcoma Viral Oncogene Homolog 1, HsT441, P61-YES, Yes, c-yes)

Anti-YES1 (v-yes-1 Yamaguchi Sarcoma Viral Oncogene Homolog 1, HsT441, P61-YES, Yes, c-yes)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
253511.50 50 µg - -

3 - 19 business days*

850.00€
 
This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein... more
Product information "Anti-YES1 (v-yes-1 Yamaguchi Sarcoma Viral Oncogene Homolog 1, HsT441, P61-YES, Yes, c-yes)"
This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22. [provided by RefSeq, Applications: Suitable for use in ELISA, Western Blot, In situ Proximity Ligation Assay (Cell). Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 253511

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 3C6
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: YES1 (AAH48960, 1aa-80aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-YES1 (v-yes-1 Yamaguchi Sarcoma Viral Oncogene Homolog 1, HsT441, P61-YES, Yes, c-yes)"
Write a review
or to review a product.
Viewed