Anti-YEATS4 (YEATS Domain Containing 4, 4930573H17Rik, B230215M10Rik, GAS41, NUBI-1, YAF9)

Anti-YEATS4 (YEATS Domain Containing 4, 4930573H17Rik, B230215M10Rik, GAS41, NUBI-1, YAF9)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
135479.50 50 µg - -

9 - 20 business days*

850.00€
 
Applications:|Suitable for use in Immunofluorescence and Western Blot. Other applications not... more
Product information "Anti-YEATS4 (YEATS Domain Containing 4, 4930573H17Rik, B230215M10Rik, GAS41, NUBI-1, YAF9)"
Applications:, Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI*, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 135479

Properties

Application: IF, WB
Antibody Type: Polyclonal
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Full length human YEATS4, aa1-228 (AAH00994).
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-YEATS4 (YEATS Domain Containing 4, 4930573H17Rik, B230215M10Rik, GAS41, NUBI-1, YAF9)"
Write a review
or to review a product.
Viewed