Anti-YARS (Tyrosine--tRNA ligase, Cytoplasmic, Tyrosyl-tRNA Synthetase, TyrRS)

Anti-YARS (Tyrosine--tRNA ligase, Cytoplasmic, Tyrosyl-tRNA Synthetase, TyrRS)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
135473.50 50 µg - -

3 - 19 business days*

715.00€
 
Applications:|Suitable for use in ELISA and Western Blot. Other applications not... more
Product information "Anti-YARS (Tyrosine--tRNA ligase, Cytoplasmic, Tyrosyl-tRNA Synthetase, TyrRS)"
Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 135473

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 2F3
Conjugate: No
Host: Mouse
Species reactivity: human, mouse
Format: Affinity Purified

Database Information

UniProt ID : P54577 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-YARS (Tyrosine--tRNA ligase, Cytoplasmic, Tyrosyl-tRNA Synthetase, TyrRS)"
Write a review
or to review a product.
Viewed