Anti-Wnt2b

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59244.50 50 µl - -

10 - 15 business days*

584.00€
 
Protein function: Ligand for members of the frizzled family of seven transmembrane receptors.... more
Product information "Anti-Wnt2b"
Protein function: Ligand for members of the frizzled family of seven transmembrane receptors. Functions in the canonical Wnt/beta- catenin signaling pathway. Plays a redundant role in embryonic lung development. [The UniProt Consortium]
Keywords: Anti-WNT2B, Anti-WNT13, Anti-Protein Wnt-13, Anti-Protein Wnt-2b
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59244

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, bovine, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the middle region of Human Wnt2b. (within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT)
MW: 41 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Wnt2b"
Write a review
or to review a product.
Viewed