Anti-VIP

Anti-VIP
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40773.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: VIP causes vasodilation, lowers arterial blood pressure, stimulates myocardial... more
Product information "Anti-VIP"
Protein function: VIP causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder. [The UniProt Consortium]
Keywords: Anti-VIP
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40773

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, cow, dog, horse, swine, rabbit, sheep)
Immunogen: Synthetic peptide around the middle region of Human VIP (within the following region: VPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELE)
MW: 19 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-VIP"
Write a review
or to review a product.
Viewed