Anti-Vinexin / SORBS3

Anti-Vinexin / SORBS3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ6010 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Vinexin is a protein that in humans is... more
Product information "Anti-Vinexin / SORBS3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Vinexin is a protein that in humans is encoded by the SORBS3 gene. It is mapped to 8p21.3. This gene encodes an SH3 domain-containing adaptor protein. The presence of SH3 domains play a role in this protein's ability to bind other cytoplasmic molecules and contribute to cystoskeletal organization, cell adhesion and migration, signaling, and gene expression. Multiple transcript variants encoding different isoforms have been found for this gene. Protein function: Vinexin alpha isoform promotes up-regulation of actin stress fiber formation. Vinexin beta isoform plays a role in cell spreading and enhances the activation of JNK/SAPK in response to EGF stimulation by using its third SH3 domain. [The UniProt Consortium]
Keywords: Anti-SCAM1, Anti-SCAM-1, Anti-SORBS3, Anti-Vinexin, Anti-SH3-containing adapter molecule 1, Anti-Sorbin and SH3 domain-containing protein 3, Vinexin Antibody / SORBS3
Supplier: NSJ Bioreagents
Supplier-Nr: RQ6010

Properties

Application: WB, IHC (paraffin), IF, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids ASTKIPASQHTQNWSATWTKDSKRRDKRWVKYE from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Vinexin / SORBS3"
Write a review
or to review a product.
Viewed