Anti-UVRAG (UV Radiation Resistance-associated Gene Protein, p63, DHTX, VPS38)

Anti-UVRAG (UV Radiation Resistance-associated Gene Protein, p63, DHTX, VPS38)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
135191.100 100 µg - -

5 - 10 business days*

850.00€
 
UVRAG complements the ultraviolet sensitivity of xeroderma pigmentosum group C cells and encodes... more
Product information "Anti-UVRAG (UV Radiation Resistance-associated Gene Protein, p63, DHTX, VPS38)"
UVRAG complements the ultraviolet sensitivity of xeroderma pigmentosum group C cells and encodes a protein with a C2 domain. The protein activates the Beclin1-PI(3)KC3 complex, promoting autophagy and suppressing the proliferation and tumorigenicity of human colon cancer cells. Chromosomal aberrations involving this gene are associated with left-right axis malformation and mutations in this gene have been associated with colon cancer. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LPSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFRRPRRSSDK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 135191

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 2E8
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-UVRAG (UV Radiation Resistance-associated Gene Protein, p63, DHTX, VPS38)"
Write a review
or to review a product.
Viewed