Anti-USP21 (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-

Anti-USP21 (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-
Item number Size Datasheet Manual SDS Delivery time Quantity Price
U4101-06E.100 100 µg - -

5 - 10 business days*

850.00€
 
USP21 is a ubiquitin-specific protease, an enzyme that removes ubiquitin from ubiquitinated... more
Product information "Anti-USP21 (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-"
USP21 is a ubiquitin-specific protease, an enzyme that removes ubiquitin from ubiquitinated proteins. The encoded protein belongs to the C19 peptidase family, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. This protein has been reported to be capable of removing NEDD8 from NEDD8 conjugates. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: FSASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQEPPRCL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: EC=3.4.19.12, Anti-Ubiquitin thioesterase 21, Anti-Deubiquitinating enzyme 21, Anti-Ubiquitin carboxyl-terminal hydrolase 21, Anti-Ubiquitin-specific-processing protease 21
Supplier: United States Biological
Supplier-Nr: U4101-06E

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 3D10
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: USP21 (NP_036607, 466-566aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-USP21 (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-"
Write a review
or to review a product.
Viewed