Anti-UCP2 (Middle Region)

Anti-UCP2 (Middle Region)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32924 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Mitochondrial uncoupling proteins (UCP)... more
Product information "Anti-UCP2 (Middle Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed in many tissues, with the greatest expression in skeletal muscle. It is thought to play a role in nonshivering thermogenesis, obesity and diabetes. Chromosomal order is 5'-UCP3-UCP2-3'. Protein function: UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat. [The UniProt Consortium]
Keywords: Anti-UCP2, Anti-UCPH, Anti-UCP 2, Anti-SLC25A8, Anti-Solute carrier family 25 member 8, Anti-Mitochondrial uncoupling protein 2, UCP2 Antibody (Middle Region)
Supplier: NSJ Bioreagents
Supplier-Nr: R32924

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids 134-170 (AQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREE) were used as the immunogen for the UCP2 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-UCP2 (Middle Region)"
Write a review
or to review a product.
Viewed