Anti-UBE2Q2

Anti-UBE2Q2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32289 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. UBE2Q2 is identified as a putative... more
Product information "Anti-UBE2Q2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. UBE2Q2 is identified as a putative ubiquitin-conjugating enzyme (E2) in a microarray screen for mitotic regulatory proteins. Its gene is mapped to 15q24.2. It can covalently bind ubiquitin on the active site cysteine within the UBC domain. Inhibition of UBE2Q2 in HeLa cells causes an early mitotic arrest and increases cytotoxicity when the cells are treated with microtubule-inhibiting agents (MIAs). Changes in cell cycle progression and viability are not observed in the absence of MIA treatment, indicating that UBE2Q2 is involved in the response to MIAs rather than performing a more general function in mitosis. Moreover, inhibition of the protein causes cells to undergo a prolonged prophase arrest, suggesting that UBE2Q2 normally functions to antagonize an early mitotic checkpoint. Finally, inhibition of UBE2Q2 also sensitizes cells to the cytotoxic effects of MIAs through caspase-mediated apoptosis that is correlated with PARP1 cleavage. Protein function: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys- 48'-linked polyubiquitination. [The UniProt Consortium]
Keywords: Anti-UBE2Q2, Anti-Ubiquitin-protein ligase Q2, Anti-Ubiquitin carrier protein Q2, Anti-Ubiquitin-conjugating enzyme E2 Q2, Anti-E2 ubiquitin-conjugating enzyme Q2, UBE2Q2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32289

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ of human UBE2Q2 were used as the immunogen for the UBE2Q2 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-UBE2Q2"
Write a review
or to review a product.
Viewed