Anti-UBE1C / UBA3

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32284 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. NEDD8-activating enzyme E1 catalytic... more
Product information "Anti-UBE1C / UBA3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. NEDD8-activating enzyme E1 catalytic subunit is a protein that in humans is encoded by the UBA3 gene. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, an ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. Protein function: Catalytic subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. Down-regulates steroid receptor activity. Necessary for cell cycle progression. [The UniProt Consortium]
Keywords: Anti-UBA3, Anti-UBE1C, EC=6.3.2.-, Anti-NEDD8-activating enzyme E1C, Anti-Ubiquitin-activating enzyme 3, Anti-Ubiquitin-activating enzyme E1C, Anti-Ubiquitin-like modifier-activating enzyme 3, Anti-NEDD8-activating enzyme E1 catalytic subunit, UBE1C Antib
Supplier: NSJ Bioreagents
Supplier-Nr: R32284

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD of human UBE1C/UBA3 were used as the immunogen for the UBE1C antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-UBE1C / UBA3"
Write a review
or to review a product.
Viewed