Anti-UBA1 / UBE1

Anti-UBA1 / UBE1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59228.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Catalyzes the first step in ubiquitin conjugation to mark cellular proteins for... more
Product information "Anti-UBA1 / UBE1"
Protein function: Catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation through the ubiquitin- proteasome system (PubMed:1606621, PubMed:1447181). Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding a ubiquitin-E1 thioester and free AMP (PubMed:1447181). Essential for the formation of radiation- induced foci, timely DNA repair and for response to replication stress. Promotes the recruitment of TP53BP1 and BRCA1 at DNA damage sites (PubMed:22456334). [The UniProt Consortium]
Keywords: Anti-UBA1, Anti-A1S9T, Anti-Protein A1S9, Anti-Ubiquitin-activating enzyme E1, Anti-Ubiquitin-like modifier-activating enzyme 1
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59228

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat (Expected: bovine, horse, monkey, rabbit)
Immunogen: Synthetic peptide corresponding to aa. 102-139 of Human UBA1. (HDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELN)
MW: 118 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-UBA1 / UBE1"
Write a review
or to review a product.
Viewed