Anti-TUB / Tubby protein homolog

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59102.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Functions in signal transduction from heterotrimeric G protein-coupled... more

Close menu

Product information "Anti-TUB / Tubby protein homolog"

Protein function: Functions in signal transduction from heterotrimeric G protein-coupled receptors. Binds to membranes containing phosphatidylinositol 4,5-bisphosphate. Can bind DNA (in vitro). May contribute to the regulation of transcription in the nucleus. Could be involved in the hypothalamic regulation of body weight. Contribute to stimulation of phagocytosis of apoptotic retinal pigment epithelium (RPE) cells and macrophages. [The UniProt Consortium]

Keywords:	Anti-TUB, Anti-Tubby protein homolog
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59102

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Synthetic peptide corresponding to aa. 395-429 of Human TUB / Tubby protein homolog. (VHERVSIRPRNEHETLLARWQNKNTESIIELQNKT)
MW:	56 kD
Format:	Antigen Affinity Purified