Anti-TSG6

Anti-TSG6
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32752 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tumor necrosis factor-inducible gene 6... more
Product information "Anti-TSG6"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tumor necrosis factor-inducible gene 6 protein, also known as TSG-6, is a protein that in humans is encoded by the TNFAIP6 gene. The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis. Protein function: Possibly involved in cell-cell and cell-matrix interactions during inflammation and tumorigenesis. [The UniProt Consortium]
Keywords: Anti-TSG6, Anti-TSG-6, Anti-TNFAIP6, Anti-TNF alpha-induced protein 6, Anti-Hyaluronate-binding protein, Anti-TNF-stimulated gene 6 protein, Anti-Tumor necrosis factor alpha-induced protein 6, Anti-Tumor necrosis factor-inducible gene 6 protein, TSG6 Anti
Supplier: NSJ Bioreagents
Supplier-Nr: R32752

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids 46-91 (KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-TSG6"
Write a review
or to review a product.
Viewed