Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R32752 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tumor necrosis factor-inducible gene 6... more
Product information "Anti-TSG6"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tumor necrosis factor-inducible gene 6 protein, also known as TSG-6, is a protein that in humans is encoded by the TNFAIP6 gene. The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis. Protein function: Possibly involved in cell-cell and cell-matrix interactions during inflammation and tumorigenesis. [The UniProt Consortium]
Keywords: | Anti-TSG6, Anti-TSG-6, Anti-TNFAIP6, Anti-TNF alpha-induced protein 6, Anti-Hyaluronate-binding protein, Anti-TNF-stimulated gene 6 protein, Anti-Tumor necrosis factor alpha-induced protein 6, Anti-Tumor necrosis factor-inducible gene 6 protein, TSG6 Anti |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R32752 |
Properties
Application: | WB |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human, rat |
Immunogen: | Amino acids 46-91 (KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR) from the human protein |
Format: | Purified |
Database Information
KEGG ID : | K19018 | Matching products |
UniProt ID : | P98066 | Matching products |
Gene ID | GeneID 7130 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed