Anti-TRPV5

Anti-TRPV5
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32330 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transient receptor potential cation... more
Product information "Anti-TRPV5"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transient receptor potential cation channel subfamily V member 5 is a protein that in humans is encoded by the TRPV5 gene. This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. And this protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. In addition, TRPV5 is mainly expressed in kidney epithelial cells, where it plays an important role in the reabsorption of Ca2+. Genetic deletion of TRPV5 in mice leads to Ca2+ loss in the urine, and consequential hyperparathyroidism, and bone loss. Protein function: Constitutively active calcium selective cation channel thought to be involved in Ca(2+) reabsorption in kidney and intestine. The channel is activated by low internal calcium level and the current exhibits an inward rectification. A Ca(2+)- dependent feedback regulation includes fast channel inactivation and slow current decay. Heteromeric assembly with TRPV6 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating. [The UniProt Consortium]
Keywords: Anti-ECaC, Anti-CaT2, Anti-ECaC1, Anti-TRPV5, Anti-ECAC1, Anti-TrpV5, Anti-OTRPC3, Anti-Osm-9-like TRP channel 3, Anti-Calcium transport protein 2, Anti-Epithelial calcium channel 1, Anti-Transient receptor potential cation channel subfamily V member 5, T
Supplier: NSJ Bioreagents
Supplier-Nr: R32330

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids DTHWRVAQERDELWRAQVVATTVMLERKLPR of human TRPV5 were used as the immunogen for the TRPV5 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-TRPV5"
Write a review
or to review a product.
Viewed