Anti-TRPV3

Anti-TRPV3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ7109 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transient receptor potential cation... more
Product information "Anti-TRPV3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transient receptor potential cation channel, subfamily V, member 3, also known as TRPV3, is a human gene encoding the protein of the same name. This gene product belongs to a family of nonselective cation channels that function in a variety of processes, including temperature sensation and vasoregulation. The thermosensitive members of this family are expressed in subsets of sensory neurons that terminate in the skin, and are activated at distinct physiological temperatures. This channel is activated at temperatures between 22 and 40 degrees C. This gene lies in close proximity to another family member gene on chromosome 17, and the two encoded proteins are thought to associate with each other to form heteromeric channels. Multiple transcript variants encoding different isoforms have been found for this gene. Protein function: Putative receptor-activated non-selective calcium permeant cation channel. It is activated by innocuous (warm) temperatures and shows an increased response at noxious temperatures greater than 39 degrees Celsius. Activation exhibits an outward rectification. May associate with TRPV1 and may modulate its activity. Is a negative regulator of hair growth and cycling: TRPV3-coupled signaling suppresses keratinocyte proliferation in hair follicles and induces apoptosis and premature hair follicle regression (catagen). [The UniProt Consortium]
Keywords: Anti-TrpV3, Anti-VRL-3, Anti-TRPV3, Anti-Vanilloid receptor-like 3, Anti-Transient receptor potential cation channel subfamily V member 3, TRPV3 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ7109

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids VRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETSV
Format: Neuro & Channel Proteins

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-TRPV3"
Write a review
or to review a product.
Viewed