Anti-TRIP6 (Thyroid Hormone Receptor Interactor 6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, O

Anti-TRIP6 (Thyroid Hormone Receptor Interactor 6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, O
Item number Size Datasheet Manual SDS Delivery time Quantity Price
253018.100 100 µg - -

5 - 10 business days*

850.00€
 
This gene is a member of the zyxin family and encodes a protein with three LIM zinc-binding... more
Product information "Anti-TRIP6 (Thyroid Hormone Receptor Interactor 6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, O"
This gene is a member of the zyxin family and encodes a protein with three LIM zinc-binding domains. This protein localizes to focal adhesion sites and along actin stress fibers. Recruitment of this protein to the plasma membrane occurs in a lysophosphatidic acid (LPA)-dependent manner and it regulates LPA-induced cell migration. Alternatively spliced variants which encode different protein isoforms have been described, however, not all variants have been fully characterized. [provided by RefSeq. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot, Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 253018

Properties

Application: ELISA, IF, IP, WB
Antibody Type: Monoclonal
Clone: 3D12
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: TRIP6 (NP_003293, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-TRIP6 (Thyroid Hormone Receptor Interactor 6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, O"
Write a review
or to review a product.
Viewed