Anti-TRIM55 / MURF2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG40722.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: May regulate gene expression and protein turnover in muscle cells. [The UniProt... more

Close menu

Product information "Anti-TRIM55 / MURF2"

Protein function: May regulate gene expression and protein turnover in muscle cells. [The UniProt Consortium]

Keywords:	Anti-MuRF2, Anti-MURF2, Anti-MuRF-2, Anti-TRIM55, Anti-RING finger protein 29, Anti-Muscle-specific RING finger protein 2, Anti-Tripartite motif-containing protein 55
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG40722

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, cow, dog, guinea pig, horse, rabbit, zebrafish)
Immunogen:	Synthetic peptide around the N-terminal region of Human TRIM55. (within the following region: SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ)
MW:	60 kD
Format:	Affinity Purified