Anti-TRIM31

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG41699.50	50 µl		-	-	10 - 15 business days*		584.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Regulator of Src-induced anchorage independent cell growth. May have E3... more

Close menu

Product information "Anti-TRIM31"

Protein function: Regulator of Src-induced anchorage independent cell growth. May have E3 ubiquitin-protein ligase activity. [The UniProt Consortium]

Keywords:	Anti-TRIM31, Anti-C6orf13, EC=2.3.2.27, Anti-E3 ubiquitin-protein ligase TRIM31, Anti-Tripartite motif-containing protein 31, Anti-RING-type E3 ubiquitin transferase TRIM31
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG41699

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Synthetic peptide around the middle region of Human TRIM31. (within the following region: HSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAAL)
MW:	48 kD
Format:	Affinity Purified