Anti-Transferrin

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31874 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transferrins are iron-binding blood plasma... more
Product information "Anti-Transferrin"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly. Protein function: Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also have a further role in stimulating cell proliferation. [The UniProt Consortium]
Keywords: Anti-PRO1400, Anti-Transferrin, Anti-Siderophilin, Anti-Serotransferrin, Anti-Beta-1 metal-binding globulin, Transferrin Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31874

Properties

Application: WB, IHC (paraffin), FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids VPDKTVRWCAVSEHEATKCQSFRDHMKSVI of human Transferrin
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Transferrin"
Write a review
or to review a product.
Viewed