Anti-TPP1

Anti-TPP1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31801 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tripeptidyl-peptidase 1, also known as... more
Product information "Anti-TPP1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tripeptidyl-peptidase 1, also known as Lysosomal pepstatin-insensitive protease, is an enzyme that in humans is encoded by the TPP1 gene. This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome. Protein function: Lysosomal serine protease with tripeptidyl-peptidase I activity. May act as a non-specific lysosomal peptidase which generates tripeptides from the breakdown products produced by lysosomal proteinases. Requires substrates with an unsubstituted N-terminus. [The UniProt Consortium]
Keywords: Anti-LPIC, Anti-CLN2, Anti-TPP1, Anti-GIG1, Anti-TPP-1, Anti-TPP-I, EC=3.4.14.9, Anti-Tripeptidyl-peptidase I, Anti-Tripeptidyl-peptidase 1, Anti-Tripeptidyl aminopeptidase, Anti-Cell growth-inhibiting gene 1 protein, TPP1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31801

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids CAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV of human TPP1 were used as the immunogen for the TPP1 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-TPP1"
Write a review
or to review a product.
Viewed