Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-RQ4951 | 100 µg | - | - |
3 - 10 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Eva-1 homolog A (C. elegans) is a protein... more
Product information "Anti-TMEM166 / EVA1A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Eva-1 homolog A (C. elegans) is a protein that in humans is encoded by the EVA1A gene. It belongs to the FAM176 family. This gene is mapped to 2p12. EVA1A, also called TMEM166, acts as a regulator of programmed cell death, mediating both autophagy and apoptosis. Protein function: Acts as a regulator of programmed cell death, mediating both autophagy and apoptosis. [The UniProt Consortium]
| Keywords: | Anti-SP24, Anti-EVA1A, Anti-FAM176A, Anti-Protein FAM176A, Anti-Protein eva-1 homolog A, Anti-Transmembrane protein 166, TMEM166 Antibody / EVA1A |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | RQ4951 |
Properties
| Application: | WB, IHC (paraffin), FC |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human |
| Immunogen: | Amino acids MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA from the human protein |
| Format: | Purified |
Database Information
| UniProt ID : | Q9H8M9 | Matching products |
| Gene ID : | GeneID 84141 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed