Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-R32715 | 100 µg | - | - |
3 - 10 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Metalloproteinase inhibitor 3 is a protein... more
Product information "Anti-TIMP3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Metalloproteinase inhibitor 3 is a protein that in humans is encoded by the TIMP3 gene. It is mapped to 22q12.1-q13.2. This gene belongs to the tissue inhibitor of metalloproteinases gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of theextracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy. Protein function: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15. [The UniProt Consortium]
| Keywords: | Anti-TIMP3, Anti-TIMP-3, Anti-Protein MIG-5, Anti-Metalloproteinase inhibitor 3, Anti-Tissue inhibitor of metalloproteinases 3, TIMP3 Antibody |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | R32715 |
Properties
| Application: | WB, ELISA |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
| Immunogen: | Amino acids 107-141 (RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL) from the human protein |
| Format: | Purified |
Database Information
| KEGG ID : | K16866 | Matching products |
| UniProt ID : | P35625 | Matching products |
| Gene ID : | GeneID 7078 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed