Anti-TIMP3

Anti-TIMP3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32715 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Metalloproteinase inhibitor 3 is a protein... more
Product information "Anti-TIMP3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Metalloproteinase inhibitor 3 is a protein that in humans is encoded by the TIMP3 gene. It is mapped to 22q12.1-q13.2. This gene belongs to the tissue inhibitor of metalloproteinases gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of theextracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy. Protein function: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15. [The UniProt Consortium]
Keywords: Anti-TIMP3, Anti-TIMP-3, Anti-Protein MIG-5, Anti-Metalloproteinase inhibitor 3, Anti-Tissue inhibitor of metalloproteinases 3, TIMP3 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32715

Properties

Application: WB, ELISA
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids 107-141 (RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-TIMP3"
Write a review
or to review a product.
Viewed