Anti-Thrombospondin 2 / THBS2

Anti-Thrombospondin 2 / THBS2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4469 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Thrombospondin-2 (THBS2) is a protein that... more
Product information "Anti-Thrombospondin 2 / THBS2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Thrombospondin-2 (THBS2) is a protein that in humans is encoded by the THBS2 gene. The protein encoded by this gene belongs to the thrombospondin family. The THBS2 is mapped to 6q27 and it is located on chromosome 17. The gene was transcribed in fibroblasts, smooth muscle cells, and an osteosarcoma cell line. It functions as a protein inhibitor of tumor growth and angiogenesis and modulates the cell surface properties of mesenchymal cells and be involved in cell adhesion and migration. Protein function: Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties. [The UniProt Consortium]
Keywords: Anti-TSP2, Anti-THBS2, Anti-Thrombospondin-2, Thrombospondin 2 Antibody / THBS2
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4469

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids DHVKDTSFDLFSISNINRKTIGAKQFRGPD
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Thrombospondin 2 / THBS2"
Write a review
or to review a product.
Viewed