Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-R32729 | 100 µg | - | - |
7 - 12 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tissue factor pathway inhibitor 2, also... more
Product information "Anti-TFPI2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tissue factor pathway inhibitor 2, also known as TFPI2, is a human gene which is located at 7q22. It is an important regulator of the extrinsic pathway of blood coagulation through its ability to inhibit factor Xa and factor VIIa-tissue factor activity. After a 22-residue signal peptide, the mature TFPI2 protein contains 213 amino acids with 18 cysteines and 2 canonical N-linked glycosylation sites. The purified recombinant TFPI2 strongly inhibited the amidolytic activities of trypsin and the factor VIIa-tissue factor complex. The latter inhibition was markedly enhanced in the presence of heparin. Mouse TFPI2 mRNA is highly expressed in developing mouse placenta, as in human. And there are also high transcript levels in adult mouse liver and kidney. Protein function: May play a role in the regulation of plasmin-mediated matrix remodeling. Inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. Has no effect on thrombin. [The UniProt Consortium]
| Keywords: | Anti-PP5, Anti-TFPI2, Anti-TFPI-2, Anti-Placental protein 5, Anti-Tissue factor pathway inhibitor 2, TFPI2 Antibody |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | R32729 |
Properties
| Application: | WB, IHC (paraffin), FC |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
| Immunogen: | Amino acids 70-105 (EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ) from the human protein |
| Format: | Purified |
Database Information
| KEGG ID : | K23087 | Matching products |
| UniProt ID : | P48307 | Matching products |
| Gene ID : | GeneID 7980 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed