Anti-TCP1 alpha / CCT1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31992 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. T-complex protein 1 subunit alpha is a... more
Product information "Anti-TCP1 alpha / CCT1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found. Protein function: Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of proteins upon ATP hydrolysis (PubMed:25467444). The TRiC complex mediates the folding of WRAP53/TCAB1, thereby regulating telomere maintenance (PubMed:25467444). As part of the TRiC complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia (PubMed:20080638). The TRiC complex plays a role in the folding of actin and tubulin (Probable). [The UniProt Consortium]
Keywords: Anti-CCT1, Anti-TCP1, Anti-CCT-alpha, Anti-TCP-1-alpha, Anti-T-complex protein 1 subunit alpha, Anti-Chaperonin containing T-complex polypeptide 1 subunit 1, TCP1 alpha Antibody / CCT1
Supplier: NSJ Bioreagents
Supplier-Nr: R31992

Properties

Application: WB, IHC (paraffin), IF
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS of human T-complex protein 1 subunit alpha
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-TCP1 alpha / CCT1"
Write a review
or to review a product.
Anti-TCP1 Anti-TCP1
836.00€ *
Anti-TCP1 Anti-TCP1
From 165.00€ *
Anti-TCP1 Anti-TCP1
From 165.00€ *
Anti-TCP1 Anti-TCP1
From 165.00€ *
Viewed