Anti-Talin 2 / TLN2

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32413 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Talin 2 is a protein in humans that is... more
Product information "Anti-Talin 2 / TLN2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Talin 2 is a protein in humans that is encoded by the TLN2 gene. It belongs to the talin protein family. This gene encodes a protein related to talin 1, a cytoskeletal protein that plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. Talin-2 is expressed at high levels in cardiac muscle and functions to provide linkages between the extracellular matrix and actin cytoskeleton at costamere structures to transduce force laterally. Protein function: As a major component of focal adhesion plaques that links integrin to the actin cytoskeleton, may play an important role in cell adhesion. Recruits PIP5K1C to focal adhesion plaques and strongly activates its kinase activity. [The UniProt Consortium]
Keywords: Anti-TLN2, Anti-Talin-2, Anti-KIAA0320, Talin 2 Antibody / TLN2
Supplier: NSJ Bioreagents
Supplier-Nr: R32413

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEV were used as the immunogen for the Talin 2 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Talin 2 / TLN2"
Write a review
or to review a product.
Viewed