Anti-Talin 2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG41971.50	50 µg		-	-	10 - 15 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: As a major component of focal adhesion plaques that links integrin to the actin... more

Close menu

Product information "Anti-Talin 2"

Protein function: As a major component of focal adhesion plaques that links integrin to the actin cytoskeleton, may play an important role in cell adhesion. Recruits PIP5K1C to focal adhesion plaques and strongly activates its kinase activity. [The UniProt Consortium]

Keywords:	Anti-TLN2, Anti-Talin-2, Anti-KIAA0320
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG41971

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 1787-1822 of Human Talin 2. (NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEV)
MW:	272 kD
Format:	Antigen Affinity Purified