Anti-TAL1 (T-Cell Acute Lymphocytic Leukemia 1, SCL, TCL5, bHLHa17, tal-1)

Anti-TAL1 (T-Cell Acute Lymphocytic Leukemia 1, SCL, TCL5, bHLHa17, tal-1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
252366.50 50 µg - -

3 - 19 business days*

850.00€
 
Mouse polyclonal antibody raised against a full-length human TAL1 protein.||Applications:... more
Product information "Anti-TAL1 (T-Cell Acute Lymphocytic Leukemia 1, SCL, TCL5, bHLHa17, tal-1)"
Mouse polyclonal antibody raised against a full-length human TAL1 protein. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRMouse polyclonal antibody raised against a full-length human TAL1 protein.AEPPVIELGARGGPGGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQLSPPALAAPAAPGRALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITDGPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 252366

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: TAL1 (AAI60033.1, 1aa-331aa) full-length human protein.
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-TAL1 (T-Cell Acute Lymphocytic Leukemia 1, SCL, TCL5, bHLHa17, tal-1)"
Write a review
or to review a product.
Viewed