Anti-Synapsin 1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59113.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Neuronal phosphoprotein that coats synaptic vesicles, binds to the... more
Product information "Anti-Synapsin 1"
Protein function: Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. The complex formed with NOS1 and CAPON proteins is necessary for specific nitric-oxid functions at a presynaptic level. [The UniProt Consortium]
Keywords: Anti-SYN1, Anti-Synapsin-1, Anti-Synapsin I, Anti-Brain protein 4.1
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59113

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat (Expected: bovine, dog, hamster, horse, monkey, rabbit)
Immunogen: Synthetic peptide corresponding to aa. 662-705 of Human Synapsin 1. (KSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASLFSD)
MW: 74 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Synapsin 1"
Write a review
or to review a product.
Viewed