Anti-Synapsin 1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59113.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Neuronal phosphoprotein that coats synaptic vesicles, binds to the... more

Close menu

Product information "Anti-Synapsin 1"

Protein function: Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. The complex formed with NOS1 and CAPON proteins is necessary for specific nitric-oxid functions at a presynaptic level. [The UniProt Consortium]

Keywords:	Anti-SYN1, Anti-Synapsin-1, Anti-Synapsin I, Anti-Brain protein 4.1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59113

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat (Expected: bovine, dog, hamster, horse, monkey, rabbit)
Immunogen:	Synthetic peptide corresponding to aa. 662-705 of Human Synapsin 1. (KSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASLFSD)
MW:	74 kD
Format:	Antigen Affinity Purified