Anti-SYCE1 (Synaptonemal Complex Central Element Protein 1, C10orf94, RP11-108K14.6, bA108K14.6)

Anti-SYCE1 (Synaptonemal Complex Central Element Protein 1, C10orf94, RP11-108K14.6, bA108K14.6)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
252304.100 100 µg - -

5 - 10 business days*

850.00€
 
Mouse monoclonal antibody raised against a full-length recombinant SYCE1.||Applications:... more
Product information "Anti-SYCE1 (Synaptonemal Complex Central Element Protein 1, C10orf94, RP11-108K14.6, bA108K14.6)"
Mouse monoclonal antibody raised against a full-length recombinant SYCE1. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLQECKERISALNLQIEEEKNKQRQLRLAFEEQLEDLMGQHKDLWDFHMPERLAKEICALDSSKEQLLKEEKLVKATLEDVKHQLCSLCGAEGPSTLDEGLFLRSQEMouse monoclonal antibody raised against a full-length recombinant SYCE1.TVQLFQEEHRKAEELLMouse monoclonal antibody raised against a full-length recombinant SYCE1.AQRHQQLQQKCQQQQQKRQRLKEELEKHGMQVPAQAQSTQEEEAGPGDVAPRPGRPVTWWS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 252304

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 6G7
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: SYCE1 (NP_963858.1, 1aa-190aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SYCE1 (Synaptonemal Complex Central Element Protein 1, C10orf94, RP11-108K14.6, bA108K14.6)"
Write a review
or to review a product.
Viewed