Anti-Superoxide Dismutase 2 / SOD2

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31882 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SOD2 (Superoxide Dismutase 2), also called... more
Product information "Anti-Superoxide Dismutase 2 / SOD2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SOD2 (Superoxide Dismutase 2), also called IPO-B or MNSOD, is a mitochondrial matrix enzyme that scavenges oxygen radicals produced by the extensive oxidation-reduction and electron transport reactions occurring in mitochondria. This gene is a member of the iron/manganese superoxide dismutase family. Using a somatic cell hybrid panel containing different segments of chromosome 6, they demonstrated that SOD2 is located in the region 6q25.3-qter which, together with the FISH analysis, indicated that SOD2 is in the distal portion of 6q25. The SOD2 gene encodes an intramitochondrial free radical scavenging enzyme that is the first line of defense against superoxide produced as a byproduct of oxidative phosphorylation. Adeno-associated viral delivery of the human SOD2 gene resulted in suppression of optic nerve degeneration and rescue of retinal ganglion cells. The findings suggested that reactive oxygen species contributed to retinal cell death and optic nerve damage in mice with complex I deficiency, and that expression of SOD2 attenuated the disease process. Protein function: Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems. [The UniProt Consortium]
Keywords: Anti-SOD2, Anti-Superoxide dismutase [Mn], mitochondrial, Superoxide Dismutase 2 Antibody / SOD2
Supplier: NSJ Bioreagents
Supplier-Nr: R31882

Properties

Application: WB, IHC (paraffin), ICC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids QYKNVRPDYLKAIWNVINWENVTERYMACKK of human SOD2
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Superoxide Dismutase 2 / SOD2"
Write a review
or to review a product.
Viewed