Anti-SULT2A1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32194 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Bile salt sulfotransferase, also known as... more
Product information "Anti-SULT2A1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Bile salt sulfotransferase, also known as hydroxysteroid sulfotransferase (HST) or sulfotransferase 2A1 (ST2A1), is an enzyme that in humans is encoded by the SULT2A1 gene. It is mapped to 19q13.3. This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome. Protein function: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfonation of steroids and bile acids in the liver and adrenal glands. Mediates the sulfation of a wide range of steroids and sterols, including pregnenolone, androsterone, DHEA, bile acids, cholesterol and as well many xenobiotics that contain alcohol and phenol functional groups (PubMed:7678732, PubMed:2268288, PubMed:14573603, PubMed:18042734, PubMed:19589875, PubMed:21187059, PubMed:29671343, PubMed:7854148). Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Plays an important role in maintening steroid and lipid homeostasis (PubMed:21187059, PubMed:19589875, PubMed:14573603). Plays a key role in bile acid metabolism (PubMed:2268288). In addition, catalyzes the metabolic activation of potent carcinogenic polycyclic arylmethanols. [The UniProt Consortium]
Keywords: Anti-HST, Anti-ST2, Anti-ST2A1, Anti-SULT2A1, Anti-DHEA-ST, Anti-SULT2A3, Anti-DHEA-ST8, Anti-Sulfotransferase 2A1, Anti-Bile salt sulfotransferase, Anti-Hydroxysteroid Sulfotransferase, Anti-Dehydroepiandrosterone sulfotransferase, SULT2A1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32194

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids DWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE of human SULT2A1
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SULT2A1"
Write a review
or to review a product.
Viewed