Anti-SUB1 / PC4

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59273.50 50 µg - -

10 - 15 business days*

551.00€
 
Protein function: General coactivator that functions cooperatively with TAFs and mediates... more
Product information "Anti-SUB1 / PC4"
Protein function: General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA). [The UniProt Consortium]
Keywords: Anti-PC4, Anti-p14, Anti-SUB1, Anti-SUB1 homolog, Anti-Positive cofactor 4, Anti-Activated RNA polymerase II transcriptional coactivator p15
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59273

Properties

Application: IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat (Expected: hamster)
Immunogen: Synthetic peptide corresponding to aa. 96-127 of Human SUB1 / PC4. (MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL)
MW: 14 kD
Format: Antigen Affinity Purified

Database Information

UniProt ID : P53999 | Matching products
Gene ID : GeneID 10923 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SUB1 / PC4"
Write a review
or to review a product.
Viewed