Anti-STMN1 / Stathmin 1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31986 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Stathmin 1/oncoprotein 18, also known as... more
Product information "Anti-STMN1 / Stathmin 1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Stathmin 1/oncoprotein 18, also known as STMN1, is a highly conserved 17 kDa protein. This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. Protein function: Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser- 16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear. [The UniProt Consortium]
Keywords: Anti-Op18, Anti-pp19, Anti-pp17, Anti-STMN1, Anti-Prosolin, Anti-Stathmin, Anti-C1orf215, Anti-Metablastin, Anti-Protein Pr22, Anti-Oncoprotein 18, Anti-Phosphoprotein p19, Anti-Leukemia-associated phosphoprotein p18, STMN1 Antibody / Stathmin 1
Supplier: NSJ Bioreagents
Supplier-Nr: R31986

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids ASSDIQVKELEKRASGQAFELILSPRSKESVPE of human STMN1 were used as the immunogen for the Stathmin 1 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-STMN1 / Stathmin 1"
Write a review
or to review a product.
Viewed