Anti-STIP1

Anti-STIP1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32069 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. STIP1 is an adaptor protein that... more
Product information "Anti-STIP1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. STIP1 is an adaptor protein that coordinates the functions of HSP70 and HSP90 in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones. The International Radiation Hybrid Mapping Consortium mapped the STIP1 gene to 11q13. Protein function: Mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB). [The UniProt Consortium]
Keywords: Anti-Hop, Anti-STI1, Anti-STIP1, Anti-Hsc70/Hsp90-organizing protein, Anti-Stress-induced-phosphoprotein 1, Anti-Renal carcinoma antigen NY-REN-11, Anti-Transformation-sensitive protein IEF SSP 3521, STIP1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32069

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids RLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR of human STIP1 were used as the immunogen for the STIP1 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-STIP1"
Write a review
or to review a product.
Viewed