Anti-STAU1 / Staufen

Anti-STAU1 / Staufen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31848 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Double-stranded RNA-binding protein... more
Product information "Anti-STAU1 / Staufen"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Double-stranded RNA-binding protein Staufen homolog 1 is a protein that in humans is encoded by the STAU1 gene. Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. Five transcript variants resulting from alternative splicing of STAU gene and encoding three isoforms have been described. Three of these variants encode the same isoform, however, differ in their 5'UTR. Protein function: Binds double-stranded RNA (regardless of the sequence) and tubulin. May play a role in specific positioning of mRNAs at given sites in the cell by cross-linking cytoskeletal and RNA components, and in stimulating their translation at the site. [The UniProt Consortium]
Keywords: Anti-STAU, Anti-STAU1, Anti-Double-stranded RNA-binding protein Staufen homolog 1, STAU1 Antibody / Staufen
Supplier: NSJ Bioreagents
Supplier-Nr: R31848

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN of human Staufen
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-STAU1 / Staufen"
Write a review
or to review a product.
Viewed