Anti-Stathmin 1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58134.50 50 µg - -

6 - 14 business days*

559.00€
 
Protein function: Involved in the regulation of the microtubule (MT) filament system by... more
Product information "Anti-Stathmin 1"
Protein function: Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser- 16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear. [The UniProt Consortium]
Keywords: Anti-Op18, Anti-pp19, Anti-pp17, Anti-STMN1, Anti-Prosolin, Anti-Stathmin, Anti-C1orf215, Anti-Metablastin, Anti-Protein Pr22, Anti-Oncoprotein 18, Anti-Phosphoprotein p19, Anti-Leukemia-associated phosphoprotein p18
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58134

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide of Human Stathmin 1. (ASSDIQVKELEKRASGQAFELILSPRSKESVPE)
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Stathmin 1"
Write a review
or to review a product.
Viewed