Anti-STAT2

Anti-STAT2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4293 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Signal transducer and activator of... more
Product information "Anti-STAT2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Signal transducer and activator of transcription 2 is a protein that in humans is encoded by the STAT2 gene. The protein encoded by this gene is a member of the STAT protein family. The International Radiation Hybrid Mapping Consortium mapped the STAT2 gene to chromosome 12. STAT2 is a transcription factor critical to the signal transduction pathway of type I interferons. ISGF3 (STAT2) assembly involves p48 functioning as an adaptor protein to recruit Stat1 and Stat2 to an IFN-alpha-stimulated response element, Stat2 contributes a potent transactivation domain but is unable to directly contact DNA, while Stat1 stabilizes the heteromeric complex by contacting DNA directly.
Keywords: Anti-p113, Anti-STAT2, Anti-Signal transducer and activator of transcription 2, STAT2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4293

Properties

Application: WB, IF, FC, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids FQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEA
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-STAT2"
Write a review
or to review a product.
Viewed