Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-RQ4293 | 100 µg | - | - |
3 - 10 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Signal transducer and activator of... more
Product information "Anti-STAT2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Signal transducer and activator of transcription 2 is a protein that in humans is encoded by the STAT2 gene. The protein encoded by this gene is a member of the STAT protein family. The International Radiation Hybrid Mapping Consortium mapped the STAT2 gene to chromosome 12. STAT2 is a transcription factor critical to the signal transduction pathway of type I interferons. ISGF3 (STAT2) assembly involves p48 functioning as an adaptor protein to recruit Stat1 and Stat2 to an IFN-alpha-stimulated response element, Stat2 contributes a potent transactivation domain but is unable to directly contact DNA, while Stat1 stabilizes the heteromeric complex by contacting DNA directly.
| Keywords: | Anti-p113, Anti-STAT2, Anti-Signal transducer and activator of transcription 2, STAT2 Antibody |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | RQ4293 |
Properties
| Application: | WB, IF, FC, IHC (paraffin) |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human |
| Immunogen: | Amino acids FQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEA |
| Format: | Purified |
Database Information
| KEGG ID : | K11221 | Matching products |
| UniProt ID : | P52630 | Matching products |
| Gene ID : | GeneID 6773 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed