Anti-SRY / Sex-Determining Region Y (Middle Region)

Anti-SRY / Sex-Determining Region Y (Middle Region)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32850 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This intronless gene encodes a... more
Product information "Anti-SRY / Sex-Determining Region Y (Middle Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF) or Sex-determining region Y (SRY), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome), translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome. Protein function: Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. In male adult brain involved in the maintenance of motor functions of dopaminergic neurons. Involved in different aspects of gene regulation including promoter activation or repression. Promotes DNA bending. SRY HMG box recognizes DNA by partial intercalation in the minor groove. Also involved in pre-mRNA splicing. Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'. [The UniProt Consortium]
Keywords: Anti-TDF, Anti-SRY, Anti-Testis-determining factor, Anti-Sex-determining region Y protein, SRY Antibody / Sex-Determining Region Y (Middle Region)
Supplier: NSJ Bioreagents
Supplier-Nr: R32850

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids 90-130 (ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR) were used as the immunogen for the SRY antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SRY / Sex-Determining Region Y (Middle Region)"
Write a review
or to review a product.
Viewed