Anti-SRY (Sex-determining Region Y Protein, Testis-determining Factor, TDF)

Anti-SRY (Sex-determining Region Y Protein, Testis-determining Factor, TDF)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
133847.50 50 µg - -

3 - 19 business days*

850.00€
 
This intronless gene encodes a transcription factor that is a member of the high mobility group... more
Product information "Anti-SRY (Sex-determining Region Y Protein, Testis-determining Factor, TDF)"
This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome), translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome. Applications: Suitable for use in Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 133847

Properties

Application: IF, WB
Antibody Type: Polyclonal
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SRY (Sex-determining Region Y Protein, Testis-determining Factor, TDF)"
Write a review
or to review a product.
Viewed