Anti-SP2

Anti-SP2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32182 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transcription factor Sp2 is a protein that... more
Product information "Anti-SP2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transcription factor Sp2 is a protein that in humans is encoded by the SP2 gene. This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters. Protein function: Binds to GC box promoters elements and selectively activates mRNA synthesis from genes that contain functional recognition sites. [The UniProt Consortium]
Keywords: Anti-SP2, Anti-KIAA0048, Anti-Transcription factor Sp2, SP2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32182

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids QVVQIPQQALRVVQAASATLPTVPQKPSQNFQ of human SP2 were used as the immunogen for the SP2 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SP2"
Write a review
or to review a product.
Viewed