Anti-SP2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59130.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Binds to GC box promoters elements and selectively activates mRNA synthesis... more

Close menu

Product information "Anti-SP2"

Protein function: Binds to GC box promoters elements and selectively activates mRNA synthesis from genes that contain functional recognition sites. [The UniProt Consortium]

Keywords:	Anti-SP2, Anti-KIAA0048, Anti-Transcription factor Sp2
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59130

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat (Expected: hamster)
Immunogen:	Synthetic peptide corresponding to aa. 312-343 of Human SP2. (QVVQIPQQALRVVQAASATLPTVPQKPSQNFQ)
MW:	65 kD
Format:	Antigen Affinity Purified