Anti-SOX12

Anti-SOX12
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG41311.50 50 µl - -

6 - 14 business days*

551.00€
 
Protein function: Binds to the sequence 5'-AACAAT-3'. [The UniProt Consortium] more
Product information "Anti-SOX12"
Protein function: Binds to the sequence 5'-AACAAT-3'. [The UniProt Consortium]
Keywords: Anti-SOX12, Anti-SOX22, Anti-Protein SOX-22, Anti-Transcription factor SOX-12
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41311

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, dog, guinea pig, horse, swine)
Immunogen: Synthetic peptide around the C-terminal region of Human SOX12. (within the following region: DCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY)
MW: 34 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SOX12"
Write a review
or to review a product.
Viewed