Anti-Sorcin / SRI

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4661 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Sorcinis aproteinthat in humans is encoded... more
Product information "Anti-Sorcin / SRI"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Sorcinis aproteinthat in humans is encoded by theSRIgene. It is mapped to 7q21.1. This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulates excitation-contraction coupling in the heart. Alternative splicing results in multiple transcript variants encoding distinct proteins. Multiple pseudogenes exist for this gene. Protein function: Calcium-binding protein that modulates excitation- contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels. [The UniProt Consortium]
Keywords: Anti-V19, Anti-SRI, Anti-CP22, Anti-CP-22, Anti-Sorcin, Anti-22 kDa protein, Sorcin Antibody / SRI
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4661

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids TVDPQELQKALTTMGFRLSPQAVNSIAKRY
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Sorcin / SRI"
Write a review
or to review a product.
Viewed