Anti-SNRPG (Small Nuclear Ribonucleoprotein G, snRNP-G, Sm Protein G, Sm-G, SmG, PBSCG, MGC117317)

Anti-SNRPG (Small Nuclear Ribonucleoprotein G, snRNP-G, Sm Protein G, Sm-G, SmG, PBSCG, MGC117317)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
133639.100 100 µg - -

5 - 10 business days*

850.00€
 
Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing.... more
Product information "Anti-SNRPG (Small Nuclear Ribonucleoprotein G, snRNP-G, Sm Protein G, Sm-G, SmG, PBSCG, MGC117317)"
Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5.Component of the heptameric ring U7 snRNP complex, or U7 Sm protein core complex, at least composed of LSM10, LSM11, SNRPB, SNRPD3, SNRPE, SNRPF, SNRPG and U7 snRNA. Formation of the U7 snRNP is an ATP-dependent process mediated by a specialized SMN complex containing at least the Sm protein core complex and additionally, the U7-specific LSM10 and LSM11 proteins. Identified in the spliceosome C complex. Component of the U11/U12 snRNPs that are part of the U12-type spliceosome. Interacts with TACC1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV*, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 133639

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 2H8-1C12
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Full length recombinant corresponding to aa1-77 from human SNRPG (AAH00070) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SNRPG (Small Nuclear Ribonucleoprotein G, snRNP-G, Sm Protein G, Sm-G, SmG, PBSCG, MGC117317)"
Write a review
or to review a product.
Viewed