Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-R32321 | 100 µg | - | - |
3 - 10 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SET and MYND domain-containing protein 3... more
Product information "Anti-SMYD3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SET and MYND domain-containing protein 3 is a protein that in humans is encoded by the SMYD3 gene. The International Radiation Hybrid Mapping Consortium mapped the SMYD3 gene to chromosome 1. This gene encodes a histone methyltransferase which functions in RNA polymerase II complexes by an interaction with a specific RNA helicase. Multiple transcript variants encoding different isoforms have been found for this gene. Protein function: Histone methyltransferase. Specifically methylates 'Lys- 4' and 'Lys-5' of histone H3, inducing di- and tri-methylation, but not monomethylation. Plays an important role in transcriptional activation as a member of an RNA polymerase complex. Binds DNA containing 5'-CCCTCC-3' or 5'-GAGGGG-3' sequences. [The UniProt Consortium]
| Keywords: | Anti-SMYD3, Anti-ZMYND1, EC=2.1.1.43, Anti-Histone-lysine N-methyltransferase SMYD3, Anti-SET and MYND domain-containing protein 3, Anti-Zinc finger MYND domain-containing protein 1, SMYD3 Antibody |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | R32321 |
Properties
| Application: | WB, IHC (paraffin) |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human |
| Immunogen: | Amino acids QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS of human SMYD3 were used as the immunogen for the SMYD3 antibody. |
| Format: | Purified |
Database Information
| KEGG ID : | K11426 | Matching products |
| UniProt ID : | Q9H7B4 | Matching products |
| Gene ID : | GeneID 64754 | Matching products |
Handling & Safety
| Storage: | -20°C |
| Shipping: | -20°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed