Anti-SMYD3

Anti-SMYD3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32321 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SET and MYND domain-containing protein 3... more
Product information "Anti-SMYD3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SET and MYND domain-containing protein 3 is a protein that in humans is encoded by the SMYD3 gene. The International Radiation Hybrid Mapping Consortium mapped the SMYD3 gene to chromosome 1. This gene encodes a histone methyltransferase which functions in RNA polymerase II complexes by an interaction with a specific RNA helicase. Multiple transcript variants encoding different isoforms have been found for this gene. Protein function: Histone methyltransferase. Specifically methylates 'Lys- 4' and 'Lys-5' of histone H3, inducing di- and tri-methylation, but not monomethylation. Plays an important role in transcriptional activation as a member of an RNA polymerase complex. Binds DNA containing 5'-CCCTCC-3' or 5'-GAGGGG-3' sequences. [The UniProt Consortium]
Keywords: Anti-SMYD3, Anti-ZMYND1, EC=2.1.1.43, Anti-Histone-lysine N-methyltransferase SMYD3, Anti-SET and MYND domain-containing protein 3, Anti-Zinc finger MYND domain-containing protein 1, SMYD3 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32321

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS of human SMYD3 were used as the immunogen for the SMYD3 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SMYD3"
Write a review
or to review a product.
Viewed