Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| S1014-63T.100 | 100 µg | - | - |
5 - 10 business days* |
850.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Located on chromosome 1, this gene encodes for acid sphingomyelinase like phosphodiesterase 3b... more
Product information "Anti-SMPDL3B (Acid Sphingomyelinase-like Phosphodiesterase 3b, ASM-like Phosphodiesterase 3b, ASML3B"
Located on chromosome 1, this gene encodes for acid sphingomyelinase like phosphodiesterase 3b precursor protein. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FFGHHHTDSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKVRSPAEARGGGWEGLKCITTFPHSQLIHLPLTTEPQE, Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.
| Keywords: | EC=3.1.4.-, Anti-ASM-like phosphodiesterase 3b, Anti-Acid sphingomyelinase-like phosphodiesterase 3b |
| Supplier: | United States Biological |
| Supplier-Nr: | S1014-63T |
Properties
| Application: | ELISA, IP, WB |
| Antibody Type: | Monoclonal |
| Clone: | 5E12 |
| Conjugate: | No |
| Host: | Mouse |
| Species reactivity: | human |
| Immunogen: | SMPDL3B (NP_001009568, 274-373aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD. |
| Format: | Purified |
Database Information
| KEGG ID : | K01128 | Matching products |
| UniProt ID : | Q92485 | Matching products |
| Gene ID : | GeneID 27293 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed